HORDB

ID: hor000109
Uniprot ID: P01179
Protein name: Oxytocin
Gene name: Oxt
Organism: Rattus norvegicus (Rat)
Family: Vasopressin/oxytocin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005185 neurohypophyseal hormone activity; GO:0005515 protein binding; GO:0031855 oxytocin receptor binding; GO:0031894 V1A vasopressin receptor binding
GO BP: GO:0001975 response to amphetamine; GO:0002027 regulation of heart rate; GO:0002125 maternal aggressive behavior; GO:0007165 signal transduction; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007507 heart development; GO:0007565 female pregnancy; GO:0007567 parturition; GO:0007595 lactation; GO:0007613 memory; GO:0007625 grooming behavior
GO CC: NA

Sequence: CYIQNCPLG
Length: 9
Propeptide: MACPSLACCLLGLLALTSACYIQNCPLGGKRAALDLDMRKCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCATAGICCSPDGCRTDPACDPESAFSER
Signal peptide: MACPSLACCLLGLLALTSA
Modification: T9 Glycine amide
Glycosylation: NA
Mutagenesis: NA

Function: Causes contraction of the smooth muscle of the uterus and of the mammary gland;antiulcer activity;contributes to leptin's attenuation of food intake;oxytocin facilitates female sexual development;Regulates nerve activity
Mechanism: release of oxytocin from a descending pPVN-to-NTS pathway contributes to leptin's attenuation of food intake by a mechanism that involves the activation of pPVN oxytocin neurons by leptin, resulting in increased sensitivity of NTS neurons to satiety signals;oxytocin facilitates female sexual development and that this effect is mediated by a mechanism involving glial production of PGE(2).
Cross BBB: NO
Target: Oxtr
Target Unid: P70536
IC50: Prostaglandin F metabolite(PGFM) release on administeration of 10 iu of oxytocin= 18.48±3.62 pg/ml ( PubMed ID: 10454085 )
EC50: NA
ED50: NA
kd: NA
Half life: 6.78 minutes; /406.8 seconds ( PubMed ID: 10454085 )

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor000109_AF2.pdb

hor000109_ESM.pdb

Mass:	115308	Formula:	C43H67N11O13S2
Absent amino acids:	ADEFHKMRSTVW	Common amino acids:	C
pI:	5.81	Basic residues:	0
Polar residues:	5	Hydrophobic residues:	2
Hydrophobicity:	33.33	Boman Index:	102
Half-Life:	1.2 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	86.67
Instability Index:	2708.89	Extinction Coefficient cystines:	1615
Absorbance 280nm:	201.88

PubMed ID: 11764003
Title: Gastric Antisecretory and Antiulcer Activity of Oxytocin in Rats and Guinea Pigs.
PubMed ID: 15044184
Title: Evidence that paraventricular nucleus oxytocin neurons link hypothalamic leptin action to caudal brain stem nuclei controlling meal size.
PubMed ID: 18039781
Title: Oxytocin Facilitates Female Sexual Maturation Through a Glia-To-Neuron Signaling Pathway
PubMed ID: 10454085
Title: